DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and Zfp91

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_443735.2 Gene:Zfp91 / 109910 MGIID:104854 Length:572 Species:Mus musculus


Alignment Length:453 Identity:92/453 - (20%)
Similarity:173/453 - (38%) Gaps:129/453 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IIKLAT------QEEEGVTEPQEL------GGRNF------FYPEIKIEEHELDTLPRIEILERS 148
            |.||.|      ::|:....|||:      ..|::      ....::..|:...:..:...|:..
Mouse   119 IEKLTTDKDPKEEKEDDSVLPQEVSITTTRASRSWRSSSRTSISRLRDSENTRSSRSKTGSLQLV 183

  Fly   149 ANTQENQDQLEGAARRLRKRLKAEDGSSVDKDKDE---------------DGVEETAEPAPPKKR 198
            ..|:...|||:   ..:.:..::..|.|.|::::|               |..:||.:| ..::.
Mouse   184 CKTEPITDQLD---YDVPEEHQSPGGISSDEEEEEEEEMLISEEEIPFKDDPRDETYKP-HLERE 244

  Fly   199 RGRPRKSDAAVAPPQKPKE---DIQLDLKAEELDEFVDEETDPDFSCLVPSDNSSEDDGGSDGFD 260
            ..:||:....|...::.||   ::::::|.||.:...|||.                        
Mouse   245 TPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDEEP------------------------ 285

  Fly   261 SDSDFELDNGKQEFAVLPKRTVVRPKKYKKRTKPAEPKVRMSRELLEQRKKQQEEYDVIIAKFFT 325
                                    |:|..:|.|..:     |..|.::|||...:|         
Mouse   286 ------------------------PRKRGRRRKDDK-----SPRLPKRRKKPPIQY--------- 312

  Fly   326 SVLPCAI--CNLLVHNFTEMQRHHRLTHQVDPGYMMC----CGRKFTQRKVLAEHVLVHWNPDHF 384
              :.|.:  |..::.:...:|.|.:..|.:...| :|    |||.|..:|.|..|...|.:...:
Mouse   313 --VRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKY-VCPHPSCGRLFRLQKQLLRHAKHHTDQRDY 374

  Fly   385 KCSVCEKSFQNSRHLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCS 449
            .|..|.::|::|.:|..|:.:|..   :....|::|..|...|.::::| :.||...|.::|:|:
Mouse   375 ICEYCARAFKSSHNLAVHRMIHTG---EKPLQCEICGFTCRQKASLNWH-MKKHDADSFYQFSCN 435

  Fly   450 ECNKKFLTERKLKNHMSSMHDPESTI---ICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQ 509
            .|.|||..:..:..|.:..| ||..|   :....|..:.:..||..:          |||..|
Mouse   436 ICGKKFEKKDSVVAHKAKSH-PEVLIAEALAANAGALITSTDILGTN----------PEPLTQ 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856 12/79 (15%)
C2H2 Zn finger 330..351 CDD:275368 4/22 (18%)
C2H2 Zn finger 360..378 CDD:275368 8/21 (38%)
LIM 361..>400 CDD:295319 12/38 (32%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
zf-C2H2_8 389..465 CDD:292531 20/75 (27%)
C2H2 Zn finger 417..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 448..465 CDD:275368 5/16 (31%)
C2H2 Zn finger 477..498 CDD:275368 3/20 (15%)
C2H2 Zn finger 511..532 CDD:275368
C2H2 Zn finger 541..562 CDD:275368
C2H2 Zn finger 570..590 CDD:275368
C2H2 Zn finger 598..619 CDD:275368
Zfp91NP_443735.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..308 42/245 (17%)
zf-C2H2_8 315..392 CDD:292531 20/77 (26%)
Interaction with MAP3K14/NIK. /evidence=ECO:0000250 340..370 10/30 (33%)
C2H2 Zn finger 349..368 CDD:275368 7/18 (39%)
C2H2 Zn finger 376..396 CDD:275368 6/19 (32%)
zf-H2C2_2 388..413 CDD:290200 6/27 (22%)
C2H2 Zn finger 404..424 CDD:275368 5/20 (25%)
C2H2 Zn finger 434..450 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.