DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and KLF2

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	NP_057354.1	Gene:	KLF2 / 10365	HGNCID:	6347	Length:	355	Species:	Homo sapiens

Alignment Length:	122	Identity:	36/122 - (29%)
Similarity:	51/122 - (41%)	Gaps:	16/122 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   292 TKPAEPKVRMSRELLEQRKKQQEEYDVIIAKFFTSVLPC--AICNLLVHNFTEMQRHHRLTHQVD 354
            |.||.|     .||||.:.|:...   ...:..|:...|  |.|.......:.::.|.| ||..:
Human   244 TPPASP-----LELLEAKPKRGRR---SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLR-THTGE 299

  Fly   355 PGYMMC----CGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESHQQVHM 407
            ..| .|    ||.||.:...|..|...|.....|:|.:|:::|..|.||..|.:.||
Human   300 KPY-HCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM 355

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368	5/22 (23%)
		C2H2 Zn finger	360..378	CDD:275368	7/21 (33%)
		LIM	361..>400	CDD:295319	13/38 (34%)
		C2H2 Zn finger	386..406	CDD:275368	7/19 (37%)
		zf-C2H2_8	389..465	CDD:292531	8/19 (42%)
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368
		C2H2 Zn finger	511..532	CDD:275368
		C2H2 Zn finger	541..562	CDD:275368
		C2H2 Zn finger	570..590	CDD:275368
		C2H2 Zn finger	598..619	CDD:275368
KLF2	NP_057354.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..42
		9aaTAD. /evidence=ECO:0000269\|PubMed:31375868	43..51
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	55..90
		Interaction with WWP1. /evidence=ECO:0000250	111..268		9/31 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	120..209
		COG5048	<267..350	CDD:227381	24/84 (29%)
		zf-C2H2	272..296	CDD:278523	5/24 (21%)
		C2H2 Zn finger	274..296	CDD:275368	5/22 (23%)
		zf-H2C2_2	288..>310	CDD:290200	6/23 (26%)
		C2H2 Zn finger	304..326	CDD:275368	7/21 (33%)
		zf-H2C2_2	318..343	CDD:290200	7/24 (29%)
		C2H2 Zn finger	334..354	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910