DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and siah3

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	XP_002941011.1	Gene:	siah3 / 100497552	XenbaseID:	XB-GENE-6035790	Length:	241	Species:	Xenopus tropicalis

Alignment Length:	79	Identity:	18/79 - (22%)
Similarity:	31/79 - (39%)	Gaps:	16/79 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   526 QHMKSIHV-ESAGEHRCHICAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTST 589
            ||.::..| .|||:..|.:....:....:.|..:......||| :..:|.::...||
Frog    20 QHYQAKRVFSSAGQLVCVVNPTQNLQNGSNRSAVPEEDSSERK-EQYLCRQSVNDPQ-------- 75

  Fly   590 HTGEVLYTCPNCPM 603
                 |.:| .||:
Frog    76 -----LTSC-TCPL 83

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319
		C2H2 Zn finger	386..406	CDD:275368
		zf-C2H2_8	389..465	CDD:292531
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368
		C2H2 Zn finger	511..532	CDD:275368	2/5 (40%)
		C2H2 Zn finger	541..562	CDD:275368	2/20 (10%)
		C2H2 Zn finger	570..590	CDD:275368	3/19 (16%)
		C2H2 Zn finger	598..619	CDD:275368	3/6 (50%)
siah3	XP_002941011.1	Sina	105..229	CDD:239753
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910