DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and asb8

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	XP_002932471.1	Gene:	asb8 / 100486931	XenbaseID:	XB-GENE-6049046	Length:	280	Species:	Xenopus tropicalis

Alignment Length:	45	Identity:	12/45 - (26%)
Similarity:	20/45 - (44%)	Gaps:	8/45 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   381 PDHFKCSVC-----EKSFQNSRHLES---HQQVHMDPAVKLTFSC 417
            |.|..|.||     |...:|..|::|   :|:..:..|.:...:|
Frog    48 PLHSACMVCDPDCVELLLENGAHVDSQDGYQRTALHYAAEKDVTC 92

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319	8/23 (35%)
		C2H2 Zn finger	386..406	CDD:275368	8/27 (30%)
		zf-C2H2_8	389..465	CDD:292531	8/37 (22%)
		C2H2 Zn finger	417..438	CDD:275368	1/1 (100%)
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368
		C2H2 Zn finger	511..532	CDD:275368
		C2H2 Zn finger	541..562	CDD:275368
		C2H2 Zn finger	570..590	CDD:275368
		C2H2 Zn finger	598..619	CDD:275368
asb8	XP_002932471.1	PHA02876	<27..>179	CDD:165207	12/45 (27%)
		ANK repeat	48..75	CDD:293786	9/26 (35%)
		ANK repeat	79..107	CDD:293786	2/14 (14%)
		ANK repeat	109..140	CDD:293786
		ANK repeat	142..173	CDD:293786
		SOCS	237..279	CDD:383010
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910