DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and ZNF730

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_016881603.1 Gene:ZNF730 / 100129543 HGNCID:32470 Length:514 Species:Homo sapiens


Alignment Length:354 Identity:90/354 - (25%)
Similarity:142/354 - (40%) Gaps:54/354 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 EQRKKQQEEYDVIIAKFFTSVLPCAICNLLVHNFTEMQRHHRLTHQVDPGYMMC--CGRKFTQRK 369
            :..||....::..:....:.:..|.....:.|.|:...| |::.|.....: .|  ||:.|....
Human   135 KMHKKGYNRHNQCLTTSHSKIFQCDKYVKVFHKFSNSNR-HKIRHTSKKPF-KCKECGKLFCILS 197

  Fly   370 VLAEHVLVH--------------WNPDH-------------FKCSVCEKSFQNSRHLESHQQVHM 407
            .||:|..:|              :|...             :||..|.|:|....|..:|:::|.
Human   198 HLAQHKKIHTGEKSYKCEEYGKAFNESSNCTTHKRITEKKPYKCKECGKAFNWFSHFTTHKRIHT 262

  Fly   408 DPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLKNHMSSMHDPE 472
            .   :..:.|:.|.|.|...|.:..|   |.:...|..:.|.||.|.|.....|..| ..:|..|
Human   263 G---EKPYQCEKCGKFFNQSTNLTTH---KRIHTGEKPYKCEECGKAFNQSSNLTEH-KKIHTKE 320

  Fly   473 STIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQHMKSIHVESAG 537
            ....|:||||..:....|.||:.:.:.:||      .:|:.||......:.|.:| |..|  :.|
Human   321 QPYKCEKCGKAFKWSSTLTKHKRIHNGEKP------YKCEECGKAFNRSSTLNRH-KITH--TGG 376

  Fly   538 E-HRCHICAKVSPNARALRRH-IYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTCPN 600
            : ::...|.|....:..|..| |.|.  .|:.:||..|.|||.|...|..|...||||..|.|..
Human   377 KPYKYKECGKAFNQSSTLTIHKIIHT--VEKFYKCEECGKAFSRISHLTTHKRIHTGEKPYKCEE 439

  Fly   601 CPMTFFCSANMYKHRQRLHRAQ--YEADK 627
            |...|..|:.:..|: |:|..:  ||.::
Human   440 CGRAFNQSSTLTTHK-RIHTGEKPYECEE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 5/20 (25%)
C2H2 Zn finger 360..378 CDD:275368 7/19 (37%)
LIM 361..>400 CDD:295319 14/65 (22%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
zf-C2H2_8 389..465 CDD:292531 20/75 (27%)
C2H2 Zn finger 417..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 448..465 CDD:275368 6/16 (38%)
C2H2 Zn finger 477..498 CDD:275368 8/20 (40%)
C2H2 Zn finger 511..532 CDD:275368 6/20 (30%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 570..590 CDD:275368 8/19 (42%)
C2H2 Zn finger 598..619 CDD:275368 6/20 (30%)
ZNF730XP_016881603.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.