| Sequence 1: | NP_611117.2 | Gene: | CG8060 / 36824 | FlyBaseID: | FBgn0034113 | Length: | 1189 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_291050.1 | Gene: | Rcc1l / 94254 | MGIID: | 2137600 | Length: | 461 | Species: | Mus musculus |
| Alignment Length: | 247 | Identity: | 53/247 - (21%) |
|---|---|---|---|
| Similarity: | 94/247 - (38%) | Gaps: | 38/247 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 140 LATDSQNDVLVWGS--NKNYNLGIGNEQNTNT----------PQAVDFFRKSNLWLEQVALGAYH 192
Fly 193 SLFCDKKGHLYAVG---HGKGGRLGIGLENSLPAPK-RVKVSSKLSGDSIQCISVSRQHSLVLTH 253
Fly 254 QSLVFACGLNTDHQLGVRDAAEQLTQFKEVVALRDKGASDLVRVIACDQHSIAYGSRC------- 311
Fly 312 -VYVWGANQG-QFGINSNTPSITVPTLIKLPAKTTIRFVEANNAATVIYNEE 361 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8060 | NP_611117.2 | ANK | <46..138 | CDD:238125 | |
| ANK repeat | 56..87 | CDD:293786 | |||
| Ank_4 | 57..111 | CDD:290365 | |||
| ANK repeat | 89..121 | CDD:293786 | |||
| Ank_2 | 95..>138 | CDD:289560 | |||
| RCC1 | 147..195 | CDD:278826 | 15/59 (25%) | ||
| RCC1 | 199..251 | CDD:278826 | 12/55 (22%) | ||
| BTB | 547..>635 | CDD:295341 | |||
| BTB | 684..795 | CDD:279045 | |||
| BTB | 697..798 | CDD:197585 | |||
| SPOP_C_like | 798..>834 | CDD:269810 | |||
| Rcc1l | NP_291050.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..35 | ||
| RCC1 1. /evidence=ECO:0000255 | 55..121 | 1/2 (50%) | |||
| RCC1 2. /evidence=ECO:0000255 | 125..188 | 16/62 (26%) | |||
| RCC1 | 127..186 | CDD:278826 | 16/58 (28%) | ||
| RCC1_2 | 173..202 | CDD:290274 | 8/28 (29%) | ||
| RCC1 3. /evidence=ECO:0000255 | 190..244 | 13/56 (23%) | |||
| RCC1 | 192..242 | CDD:278826 | 12/52 (23%) | ||
| RCC1_2 | 229..258 | CDD:290274 | 10/29 (34%) | ||
| RCC1 4. /evidence=ECO:0000255 | 245..297 | 13/61 (21%) | |||
| RCC1 | 245..295 | CDD:278826 | 13/59 (22%) | ||
| RCC1 5. /evidence=ECO:0000255 | 298..350 | 7/51 (14%) | |||
| RCC1 | 298..348 | CDD:278826 | 7/49 (14%) | ||
| RCC1 6. /evidence=ECO:0000255 | 352..408 | 53/247 (21%) | |||
| RCC1_2 | 393..422 | CDD:290274 | |||
| RCC1 7. /evidence=ECO:0000255 | 409..458 | ||||
| RCC1 | 409..452 | CDD:278826 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||