Sequence 1: | NP_611117.2 | Gene: | CG8060 / 36824 | FlyBaseID: | FBgn0034113 | Length: | 1189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017919.1 | Gene: | RCCD1 / 91433 | HGNCID: | 30457 | Length: | 376 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 56/235 - (23%) |
---|---|---|---|
Similarity: | 96/235 - (40%) | Gaps: | 47/235 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 169 TPQAVDFFR--KSNLWLEQVALGAYHSLFCDKKGHLYAVGHGKGGRLGIGLENSLPAPKRVKVSS 231
Fly 232 KLSGDSIQCISVSRQHSLVLTHQSLVFACGLNTDHQLGV--RDAAEQ-LTQFKEVVALRDKGA-- 291
Fly 292 -----------------------------SDLVRVIACDQHSIAYGSRC--VYVWG-ANQGQFGI 324
Fly 325 NSNTPSITVPTLIK--LPAKTTIRFVEANNAATVIYNEEK 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8060 | NP_611117.2 | ANK | <46..138 | CDD:238125 | |
ANK repeat | 56..87 | CDD:293786 | |||
Ank_4 | 57..111 | CDD:290365 | |||
ANK repeat | 89..121 | CDD:293786 | |||
Ank_2 | 95..>138 | CDD:289560 | |||
RCC1 | 147..195 | CDD:278826 | 10/27 (37%) | ||
RCC1 | 199..251 | CDD:278826 | 13/51 (25%) | ||
BTB | 547..>635 | CDD:295341 | |||
BTB | 684..795 | CDD:279045 | |||
BTB | 697..798 | CDD:197585 | |||
SPOP_C_like | 798..>834 | CDD:269810 | |||
RCCD1 | NP_001017919.1 | Interaction with KDM8. /evidence=ECO:0000269|PubMed:24981860 | 1..169 | 9/24 (38%) | |
ATS1 | <156..340 | CDD:227511 | 45/188 (24%) | ||
RCC1 2 | 176..227 | 13/53 (25%) | |||
RCC1 3 | 229..317 | 16/88 (18%) | |||
RCC1 4 | 318..371 | 12/53 (23%) | |||
RCC1 | 319..366 | CDD:395335 | 10/47 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |