DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and UVR8

DIOPT Version :10

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_201191.1 Gene:UVR8 / 836506 AraportID:AT5G63860 Length:440 Species:Arabidopsis thaliana


Alignment Length:109 Identity:23/109 - (21%)
Similarity:39/109 - (35%) Gaps:30/109 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 FWSLFTSGENVRL--------KWKKVINFLFFMKSKSADDDFR--TKVDDLISFMVTNPLEFNAY 378
            :::|..|.|..||        :|:|              ..:|  :..|::....|:....|..|
plant    80 YYNLNVSREGGRLLMQLNDFSEWQK--------------GPYRCISSGDNITDMAVSENFTFIVY 130

  Fly   379 GLFPIDLSVLTGIASSITTYLI------VLIQFKISEEQSSGYD 416
            .|..:.|......:.|:..||:      |.|:...|.:|...||
plant   131 YLRDVYLQRANSWSPSVGDYLLVEEGANVEIKCSASADQEPYYD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANKYR <51..141 CDD:440430
ANK repeat 56..87 CDD:293786
ANK repeat 89..121 CDD:293786
ATS1 140..>355 CDD:444065 7/38 (18%)
BTB_POZ 543..643 CDD:453885
BTB2_POZ_IBtk 691..802 CDD:349611
BACK_IBtk 798..857 CDD:350575
UVR8NP_201191.1 ATS1 20..371 CDD:444065 23/109 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.