DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and Rcc1

DIOPT Version :9

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:XP_006239135.1 Gene:Rcc1 / 682908 RGDID:1592835 Length:434 Species:Rattus norvegicus


Alignment Length:240 Identity:56/240 - (23%)
Similarity:92/240 - (38%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DDDDLATDSQNDVLVWGSNKNYNLGIGNEQNTNTPQAVDFFRKSNLWLE--------QVALGAYH 192
            |....|......|.:|||.::.|..||         .::..:||.:.::        :||.|..|
  Rat   141 DSHTAALTEDGRVFLWGSFRDNNGVIG---------LLEPMKKSMVPVQVQLDTQVVKVASGNDH 196

  Fly   193 SLFCDKKGHLYAVGHGKGGRLG------------IGLENSLPAPKRVKVSSKLSGDSI--QCISV 243
            .:.....|.||.:|.|:.|:||            .|||..| .|:.|.:.|:.:...:  |....
  Rat   197 LVMLTTDGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLL-VPRCVLLKSRGTRGRVRFQDAFC 260

  Fly   244 SRQHSLVLTHQSLVFACGLNTDHQLGVRDAA-----EQLTQFKEVVALRDKGASDLVRVIACDQH 303
            ....:..::.:..|:..||:..||||.....     :.||.||       ......|.......|
  Rat   261 GAYFTFAISREGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFK-------NSTKSWVGFSGGQHH 318

  Fly   304 SIAYGSR-CVYVWG-ANQGQFGINSNTPSITVPTLI-KLPAKTTI 345
            ::...|. ..|..| |..|:.|:.......::|||| :||..:::
  Rat   319 TVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPVVSSV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANK <46..138 CDD:238125 1/1 (100%)
ANK repeat 56..87 CDD:293786
Ank_4 57..111 CDD:290365
ANK repeat 89..121 CDD:293786
Ank_2 95..>138 CDD:289560 1/1 (100%)
RCC1 147..195 CDD:278826 13/55 (24%)
RCC1 199..251 CDD:278826 16/65 (25%)
BTB 547..>635 CDD:295341
BTB 684..795 CDD:279045
BTB 697..798 CDD:197585
SPOP_C_like 798..>834 CDD:269810
Rcc1XP_006239135.1 ATS1 19..432 CDD:227511 56/240 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.