DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and RCC2

DIOPT Version :9

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_001129676.1 Gene:RCC2 / 55920 HGNCID:30297 Length:522 Species:Homo sapiens


Alignment Length:409 Identity:85/409 - (20%)
Similarity:155/409 - (37%) Gaps:74/409 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GRSAVHMSASTARYEILEWLLNHGAYINGQDYESGSSPLHRALYYGSIDCAVLLLRYGASLELLD 121
            |..|.|....|...::..|..|....:...|.:...:|               .|..|.|.|:: 
Human   156 GSCAAHSLLITTEGKLWSWGRNEKGQLGHGDTKRVEAP---------------RLIEGLSHEVI- 204

  Fly   122 EDTRCPLQAICRKCDDDDLATDSQNDVLVWGSNKNYNLGIGNEQNTNTPQAVDFFRKSNLWLEQV 186
                  :.|.|.:  :..||......|..:|.||...||:||:.:.....|...:....  :.::
Human   205 ------VSAACGR--NHTLALTETGSVFAFGENKMGQLGLGNQTDAVPSPAQIMYNGQP--ITKM 259

  Fly   187 ALGAYHSLFCDKKGHLYAVGHGKGGRLGIGLENSLPA------------PKRVKVSSKLSGDS-- 237
            |.||..|:..|.||:||:.|..:.|:||...:....|            |:||.:..:.:.|.  
Human   260 ACGAEFSMIMDCKGNLYSFGCPEYGQLGHNSDGKFIARAQRIEYDCELVPRRVAIFIEKTKDGQI 324

  Fly   238 -------IQCISVSRQHSLVLTHQSLVFACGLNTDHQLGVRDAAEQLTQFKEVVALRD---KGAS 292
                   ::.::....|:|||..|..||:.|.....:||..:..:::.  ..:|.|.|   :|||
Human   325 LPVPNVVVRDVACGANHTLVLDSQKRVFSWGFGGYGRLGHAEQKDEMV--PRLVKLFDFPGRGAS 387

  Fly   293 DLVRVIACDQHSIAYGSRCVYVWGANQGQFGINSNTPSITVPTLIKLPAKTTIRFVEANNAATVI 357
            .:.....|.......|.  ::.|||.      |::..|...|..::......||.:....::.::
Human   388 QIYAGYTCSFAVSEVGG--LFFWGAT------NTSRESTMYPKAVQDLCGWRIRSLACGKSSIIV 444

  Fly   358 YNEEKIITLCYADKTRYIKTPNYEDLKSISVMGGNLKNSTKGSAAALKLLMLTETNVVYLWYENT 422
            ..:|..|:        :..:|.:.:|..     |:.|..:..:|..:|.|....:..|.:.|.::
Human   445 AADESTIS--------WGPSPTFGELGY-----GDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHS 496

  Fly   423 QQFYRCNFSPIRLHQIKKI 441
            ....| :.|.....:|||:
Human   497 LVIAR-DESETEKEKIKKL 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANK <46..138 CDD:238125 14/80 (18%)
ANK repeat 56..87 CDD:293786 6/29 (21%)
Ank_4 57..111 CDD:290365 8/53 (15%)
ANK repeat 89..121 CDD:293786 5/31 (16%)
Ank_2 95..>138 CDD:289560 6/42 (14%)
RCC1 147..195 CDD:278826 13/47 (28%)
RCC1 199..251 CDD:278826 15/72 (21%)
BTB 547..>635 CDD:295341
BTB 684..795 CDD:279045
BTB 697..798 CDD:197585
SPOP_C_like 798..>834 CDD:269810
RCC2NP_001129676.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
RCC1 1 103..165 3/8 (38%)
ATS1 <151..481 CDD:227511 77/373 (21%)
RCC1 2 168..219 12/74 (16%)
RCC1 3 221..271 13/51 (25%)
RCC1 4 273..347 16/73 (22%)
Required for interaction with RAC1. /evidence=ECO:0000269|PubMed:28869598 318..325 1/6 (17%)
RCC1 5 348..401 13/54 (24%)
RCC1 6 403..447 9/51 (18%)
RCC1 7 448..501 11/65 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..522 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.