DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and rcc1l

DIOPT Version :9

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_001076272.1 Gene:rcc1l / 555972 ZFINID:ZDB-GENE-060526-370 Length:451 Species:Danio rerio


Alignment Length:265 Identity:74/265 - (27%)
Similarity:109/265 - (41%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DYESGSSPLHRALYYGSIDCAVLLLRYGASLELLD-EDTRCPLQAICRKCDDDDLATDSQNDVLV 150
            ||...:||:                    ||.||: ::||.| |..|.:.....| |||:. |..
Zfish   143 DYVLEASPV--------------------SLPLLNPQETRVP-QVSCGRAHSLVL-TDSEG-VFS 184

  Fly   151 WGSNKNYNLG--IGNEQNTNTPQAVDFFRKSNLWLEQVALGAYHSLFCDKKGHLYAVGHGKGGRL 213
            .|||.....|  |..::..:....|......:..:.|||.|..||||...:|.::|.|.|..|:.
Zfish   185 MGSNTFGQCGRKIVEDEVYSGSHVVHKIEGFDSRVIQVACGQDHSLFLTDRGSVFACGWGADGQT 249

  Fly   214 GIGLENSLPAPKRVKVSSKLSGDSIQCISVSRQHSLVLTHQSLVFACGLNTDHQLGVRDAAEQLT 278
            |:|..|....|  |.|...|:|.::|.::.....||.::....||..|.:...||.   :..:.|
Zfish   250 GLGHHNKASCP--VPVGGDLAGVTVQQVATYGDCSLAVSTDGQVFGWGNSEYLQLA---SVTEST 309

  Fly   279 QFKEVVALRDKGASDLVRVIACDQHSIAY----GSRCVYVWGANQGQFGINSNTPSIT---VPTL 336
            |......|..||.. .:|..||....:|.    |.  |:|||     |||....|.::   :|. 
Zfish   310 QISSPRLLPLKGVG-RIRQAACGGTQVAVLNEDGD--VFVWG-----FGILGKGPKLSESAIPE- 365

  Fly   337 IKLPA 341
             ::||
Zfish   366 -RVPA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANK <46..138 CDD:238125 13/51 (25%)
ANK repeat 56..87 CDD:293786 74/265 (28%)
Ank_4 57..111 CDD:290365 4/23 (17%)
ANK repeat 89..121 CDD:293786 5/31 (16%)
Ank_2 95..>138 CDD:289560 9/43 (21%)
RCC1 147..195 CDD:278826 13/49 (27%)
RCC1 199..251 CDD:278826 16/51 (31%)
BTB 547..>635 CDD:295341
BTB 684..795 CDD:279045
BTB 697..798 CDD:197585
SPOP_C_like 798..>834 CDD:269810
rcc1lNP_001076272.1 RCC1 52..108 CDD:278826
RCC1_2 165..192 CDD:290274 10/28 (36%)
RCC1 182..232 CDD:278826 14/49 (29%)
RCC1_2 219..248 CDD:290274 12/28 (43%)
RCC1 236..285 CDD:278826 16/50 (32%)
RCC1 288..338 CDD:278826 14/53 (26%)
RCC1_2 383..412 CDD:290274
RCC1 400..446 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.