DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and CG6678

DIOPT Version :9

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster


Alignment Length:264 Identity:59/264 - (22%)
Similarity:102/264 - (38%) Gaps:49/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RALYYGSIDCAVLLLR---YGASLELLDEDTRCPLQAICRKCDDDDLATDSQNDVLVWGSNK--- 155
            |||......|.|||..   |....:|..|.....|:|..|        ::|.....::|:.|   
  Fly    80 RALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPR--------SNSGTKRSIFGAAKAPS 136

  Fly   156 -----------NYNLGIGNEQNT-NTPQAVDFFRKSNLWLEQVALGAYHSLFCDKKGHLYAVGHG 208
                       :.|:.|.:|... :.|..:..|.:....::|:..|..|::..:..|.::..|:|
  Fly   137 SPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNG 201

  Fly   209 KGGRLGIGLENSLPAPKRVKVSSKLSGDSIQCISVSRQHSLVLTHQSLVFACGLNTDHQLGVR-- 271
            ..|:||:.   .|...:..::...|:|..|..|:....||..::....::..|||...|||:|  
  Fly   202 LRGQLGLA---ELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVM 263

  Fly   272 --------DAAEQLTQFKEV--VALRDKGASD----LVRVIACDQHSIAYGSRCVYVW---GANQ 319
                    .....|.|.:::  .|....|.|:    .:||.|..:|::.. .||..:|   ....
  Fly   264 KPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLI-RRCGRLWVSGWCKH 327

  Fly   320 GQFG 323
            ||.|
  Fly   328 GQLG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANK <46..138 CDD:238125 13/43 (30%)
ANK repeat 56..87 CDD:293786
Ank_4 57..111 CDD:290365 6/13 (46%)
ANK repeat 89..121 CDD:293786 9/26 (35%)
Ank_2 95..>138 CDD:289560 13/43 (30%)
RCC1 147..195 CDD:278826 10/62 (16%)
RCC1 199..251 CDD:278826 13/51 (25%)
BTB 547..>635 CDD:295341
BTB 684..795 CDD:279045
BTB 697..798 CDD:197585
SPOP_C_like 798..>834 CDD:269810
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 59/264 (22%)
RCC1_2 176..205 CDD:290274 6/28 (21%)
RCC1 192..241 CDD:278826 13/51 (25%)
RCC1_2 228..257 CDD:290274 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.