DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and rcc1

DIOPT Version :9

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_998343.1 Gene:rcc1 / 406457 ZFINID:ZDB-GENE-040426-2216 Length:418 Species:Danio rerio


Alignment Length:182 Identity:51/182 - (28%)
Similarity:85/182 - (46%) Gaps:33/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 KKGHLYAVGHGKGGRLGIG---LENSLPA----PKRVKVSSKLSGDSIQCISVSRQHSLVLTHQS 255
            :||.:..:|.|..|:||:|   :|...||    |:.:          :|.:: ...|::.|:...
Zfish    33 EKGLVLVLGQGDVGQLGLGEDVMERKKPALVTLPEGI----------VQAVA-GGMHTVCLSDTG 86

  Fly   256 LVFACGLNTDHQLGVRDAAEQLTQFKEVVALRDKGASDLVRVIACDQHSIAY---GSRCVYVWGA 317
            .|:..|.|.:..|| ||.:|:.::  .|.|..|.| ..:::|.|.|.||.|.   |.  |||||:
Zfish    87 NVYTFGCNDEGALG-RDTSEEGSE--TVPAKVDLG-EKIIQVSAGDSHSAALTEDGG--VYVWGS 145

  Fly   318 ---NQGQFGINSNTPSITVPTLIKLPA-KTTIRFVEANNAATVIYNEEKIIT 365
               |.|..|:.......|||  :|:|. |..::.|..|:...::....::.|
Zfish   146 FRDNNGVIGLLEPMKKCTVP--VKVPIDKPVVKIVSGNDHLVMLTAHGELYT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANK <46..138 CDD:238125
ANK repeat 56..87 CDD:293786
Ank_4 57..111 CDD:290365
ANK repeat 89..121 CDD:293786
Ank_2 95..>138 CDD:289560
RCC1 147..195 CDD:278826
RCC1 199..251 CDD:278826 14/58 (24%)
BTB 547..>635 CDD:295341
BTB 684..795 CDD:279045
BTB 697..798 CDD:197585
SPOP_C_like 798..>834 CDD:269810
rcc1NP_998343.1 ATS1 3..415 CDD:227511 51/182 (28%)
RCC1 34..82 CDD:278826 14/58 (24%)
RCC1 86..134 CDD:278826 17/51 (33%)
RCC1 137..187 CDD:278826 17/53 (32%)
RCC1 191..252 CDD:278826 1/5 (20%)
RCC1 255..306 CDD:278826
RCC1 309..357 CDD:278826
RCC1 361..411 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.