DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and Rcc1l

DIOPT Version :10

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_001101802.1 Gene:Rcc1l / 360796 RGDID:1307558 Length:461 Species:Rattus norvegicus


Alignment Length:247 Identity:55/247 - (22%)
Similarity:95/247 - (38%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LATDSQNDVLVWGS--NKNYNLGIGNEQNTNT----------PQAVDFFRKSNLWLEQVALGAYH 192
            |::.:::...|||.  ||:..||....:...|          |..:...|.....:.||:.|..|
  Rat   118 LSSKTKDVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVPLPLDRPQETKVLQVSCGRAH 182

  Fly   193 SLFCDKKGHLYAVG---HGKGGRLGIGLENSLPAPK-RVKVSSKLSGDSIQCISVSRQHSLVLTH 253
            ||....:..::::|   ||:.||..:  |:.:.:.. :|.......|..:|.: ..:.|||.||.
  Rat   183 SLVLTDREGVFSMGNNAHGQCGRKVV--EDEVYSESHKVHRMQDFEGQVVQVV-CGQDHSLFLTD 244

  Fly   254 QSLVFACGLNTDHQLGVRDAAEQLTQFKEVVALRDKGASDLVRVIACDQHSIAYGSRC------- 311
            :..|::||...|.|.|:        ....:.:...|...||..|...  ....||..|       
  Rat   245 KGEVYSCGWGADGQTGL--------GHYNITSTPSKLGGDLAGVTVV--QVATYGDCCLALSADG 299

  Fly   312 -VYVWGANQG-QFGINSNTPSITVPTLIKLPAKTTIRFVEANNAATVIYNEE 361
             |:.||.::. |....:::..:.||..:.......::.|........|.|||
  Rat   300 GVFGWGNSEYLQLASVTDSTQVNVPRCLPFSGVGKVKQVACGGTGCAILNEE 351

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity