DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and CG9135

DIOPT Version :10

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_608985.1 Gene:CG9135 / 33850 FlyBaseID:FBgn0031769 Length:487 Species:Drosophila melanogaster


Alignment Length:216 Identity:56/216 - (25%)
Similarity:92/216 - (42%) Gaps:35/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LVWGSNKNYNLGIGNE-QNTNTPQAVDFFRKSNLWLEQVALGAYHSLFCDKKGHLYAVGHGKGGR 212
            |.:|.|.:..||:..: :....|..:....:.|  :.|.|:|.:|:||....|.:||.|..|.|:
  Fly   138 LGFGRNPSGQLGLSQDIKLAEKPTIIPALEQLN--IVQAAVGRHHTLFLTDTGTVYACGENKSGQ 200

  Fly   213 LGIGLENS---LPAPKRVKVSSKLSGDSIQCISVSRQHSLVLTHQSLVFACGLNTDHQLGVRDAA 274
            .|:|..::   .|.|...:      |..|..|....:.|::|..:..:...||....|||....|
  Fly   201 CGVGNTHANIYSPTPINYR------GPPIIRIGCGAEFSVILDIKGSLHTFGLPEYGQLGHNTDA 259

  Fly   275 EQL-----------TQFKEVVALRDKGAS------DLVRVI--AC-DQHSIAYGS-RCVYVWG-A 317
            :..           |..|:||...:|...      |.|:::  || :.|::|..| :.||.|| .
  Fly   260 KYFVNANKLSFHFETSPKKVVLYIEKSKEGHVTPVDGVQIVDFACGNNHTVAIDSKKRVYSWGFG 324

  Fly   318 NQGQFGINSNTPSITVPTLIK 338
            ..|:.| ::......||.|:|
  Fly   325 GFGRLG-HAEPKDEMVPRLMK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANKYR <51..141 CDD:440430
ANK repeat 56..87 CDD:293786
ANK repeat 89..121 CDD:293786
ATS1 140..>355 CDD:444065 56/216 (26%)
BTB_POZ 543..643 CDD:453885
BTB2_POZ_IBtk 691..802 CDD:349611
BACK_IBtk 798..857 CDD:350575
CG9135NP_608985.1 ATS1 119..469 CDD:444065 56/216 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.