DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and ZZEF1

DIOPT Version :9

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:XP_016879871.1 Gene:ZZEF1 / 23140 HGNCID:29027 Length:2966 Species:Homo sapiens


Alignment Length:663 Identity:127/663 - (19%)
Similarity:233/663 - (35%) Gaps:205/663 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 SHTKYFRKPSLPRRE-HSFKKLLHETSDC-DAVHDVVFHVDGEKFAAH-KFIIYSRAPGLRDLIR 591
            ||....:..||.:.: .|..::|..|..| :::        |:....| .||::     |.:|:.
Human  1571 SHRSVVKVLSLRKAQAQSILEVLKITQHCAESL--------GQPHCFHPPFILF-----LLELLT 1622

  Fly   592 CYLDKDIYLNFDHLTG-----------KMFELILNHIYS----------SYWPTEDDIDCIQQSL 635
            |  .||....|.||.|           ..::|:|..:.:          |..|.   :.|:|.:|
Human  1623 C--QKDFTNYFGHLEGCGADLHKEIRDTYYQLVLFLVKAVKGFSSLNDRSLLPA---LSCVQTAL 1682

  Fly   636 GPA-----NPQQRTRTCEMFLPHLEKFQLVELTKYVQSYVRDHQFPLPNARKLFNRLYRSDHPEL 695
            ...     .|.......::.||.|       |.|..|..:..|...:..         .|:..||
Human  1683 LHLLDMGWEPNDLAFFVDIQLPDL-------LMKMSQENISVHDSVISQ---------WSEEDEL 1731

  Fly   696 YDVR------IVCKDGKVLGAHKCMLVARLEYFEMMFMHLWAER------SSVTMEGVPAEYMEP 748
            .|.:      ..|:||.....::  .:|:.:..:...||::..|      ..::.:|  .:.:.|
Human  1732 ADAKQNSEWMDECQDGMFEAWYE--KIAQEDPEKQRKMHMFIARYCDLLNVDISCDG--CDEIAP 1792

  Fly   749 VLDY--LYSLDNEAFCKQGYL----------ETFLYNMITICDQYFIESLQNVCESLILDKISIR 801
            ...|  |...|.: .||..:|          :..:.||...||.         |:.||:.:    
Human  1793 WHRYRCLQCSDMD-LCKTCFLGGVKPEGHGDDHEMVNMEFTCDH---------CQGLIIGR---- 1843

  Fly   802 KCGEMLEFAAMYNCKILQKGCMDF-ICQNLSRVLCYRSIEQCDGE------------TLKCLNDH 853
                      ..||.:    |.|| :|..     ||.:.:...|.            |:: ::|.
Human  1844 ----------RMNCNV----CDDFDLCYG-----CYAAKKYSYGHLPTHSITAHPMVTIR-ISDR 1888

  Fly   854 YRKMFKRVFDYRQITPFSEAIEDELLLSF--VDGCDVDLNYRMDAESKLKQAAK---------HK 907
            .|.:...:.:|..:...:.|:....|.|.  |||..:|...|..|.:...|..:         |:
Human  1889 QRLIQPYIHNYSWLLFAALALYSAHLASAEDVDGEKLDPQTRSSATTLRSQCMQLVGDCLMKAHQ 1953

  Fly   908 QKDLRK-------QDARHQYEQQAISSMMRSLSISE-----STQGTEVPSSPQDSARSEDKNWSR 960
            .|.|:.       .|.....|.||:...:.:.:..|     :.||.|:         ||..|..|
Human  1954 GKGLKALALLGVLPDGDSSLEDQALPVTVPTGASEEQLEKKAVQGAEL---------SEAGNGKR 2009

  Fly   961 VVDKK-----DQKRKLAETALKVNNTLKHEDPPTQELVPIERKPLKEQTPP---PPSHETEPTTP 1017
            .|.::     .::|..|:..:.::     :||..|  ..|...| .:.:||   |.:.::|    
Human  2010 AVHEEIRPVDFKQRNKADKGVSLS-----KDPSCQ--TQISDSP-ADASPPTGLPDAEDSE---- 2062

  Fly  1018 LSKSYNLDFSSLTPQSQKL----SQKQRKRLSSESKSWRTNNPPLVEQSSTPV-----AVPNAWG 1073
            :|....::..::||..:::    |||:...|.:...      |||....:.|:     .:|..:.
Human  2063 VSSQKPIEEKAVTPSPEQVFAECSQKRILGLLAAML------PPLKSGPTVPLIDLEHVLPLMFQ 2121

  Fly  1074 VTTTPSGSFNDSF 1086
            |..:.:|..|:::
Human  2122 VVISNAGHLNETY 2134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANK <46..138 CDD:238125
ANK repeat 56..87 CDD:293786
Ank_4 57..111 CDD:290365
ANK repeat 89..121 CDD:293786
Ank_2 95..>138 CDD:289560
RCC1 147..195 CDD:278826
RCC1 199..251 CDD:278826
BTB 547..>635 CDD:295341 22/110 (20%)
BTB 684..795 CDD:279045 25/134 (19%)
BTB 697..798 CDD:197585 23/124 (19%)
SPOP_C_like 798..>834 CDD:269810 6/36 (17%)
ZZEF1XP_016879871.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.