DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and K11D2.1

DIOPT Version :9

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:NP_001368497.1 Gene:K11D2.1 / 187290 WormBaseID:WBGene00010768 Length:278 Species:Caenorhabditis elegans


Alignment Length:301 Identity:63/301 - (20%)
Similarity:106/301 - (35%) Gaps:105/301 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 YYGSI---DCAVLLLRYGASLELLDEDTRCP---LQAIC----------------RKCDDD---- 138
            ::|||   .|.:.|:.......|..|..:.|   ....|                |:.||.    
 Worm     8 WFGSISVDSCKITLIFDAPMTSLASETIQLPDEVKHVACTHLHMAILMKHEKLAVRRLDDFEGNL 72

  Fly   139 ---DLATDSQNDVLVWGSNKNY------------------NLGIGNEQNTNTPQAVDFFRKSNLW 182
               ||.||.  |||:..:::..                  ::||..::| |....:.|     .|
 Worm    73 TFLDLHTDL--DVLLVATSREIYAVERSGTSSEIVKILVDSVGISPKKN-NLANKIQF-----PW 129

  Fly   183 ---LEQVALGAYHSLFCDKKGHLYAVGHGKGGRLGIGLENSLPAPKRVKVSSKLSGDSIQCISVS 244
               :.:.|.|....:|.|..|:|:::|.|..|.||:||...:..|..::   :|.|..|:.::..
 Worm   130 PVRIVEAAAGHDFLIFRDTTGNLFSMGTGTRGELGVGLIRRVDEPVHIE---QLVGIRIKKVACG 191

  Fly   245 RQHSLVLTHQSLVFACGLNTDHQLGVRDAAEQLTQFKEVVALRDKGASDLVRV------------ 297
            ..|::.||.....:..|.|...|||                 :|||::::..|            
 Worm   192 GWHTVALTEGGDAYTWGWNRYGQLG-----------------KDKGSTEVYPVLIDPEEEKFGEE 239

  Fly   298 ----IACDQHS---IAYGSRCVYVWGANQGQFGINSNTPSI 331
                :||.:|:   :.......:|.|.|.        ||.|
 Worm   240 NILDVACTEHNTQIVIKTGHAPFVLGTNP--------TPPI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANK <46..138 CDD:238125 11/59 (19%)
ANK repeat 56..87 CDD:293786
Ank_4 57..111 CDD:290365 4/13 (31%)
ANK repeat 89..121 CDD:293786 6/23 (26%)
Ank_2 95..>138 CDD:289560 11/59 (19%)
RCC1 147..195 CDD:278826 11/68 (16%)
RCC1 199..251 CDD:278826 14/51 (27%)
BTB 547..>635 CDD:295341
BTB 684..795 CDD:279045
BTB 697..798 CDD:197585
SPOP_C_like 798..>834 CDD:269810
K11D2.1NP_001368497.1 ATS1 <118..>259 CDD:227511 36/166 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.