DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8060 and RCBTB2

DIOPT Version :9

Sequence 1:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster
Sequence 2:XP_016875858.1 Gene:RCBTB2 / 1102 HGNCID:1914 Length:561 Species:Homo sapiens


Alignment Length:788 Identity:152/788 - (19%)
Similarity:237/788 - (30%) Gaps:325/788 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ASLELLDEDTRCPLQAICRK--------------CDDDDLATDSQNDVLVWGSNKNYNLGIGNEQ 165
            :||::||.. :.|:.::|.:              ..::.|.|...:::.|.|:|....||:|:.|
Human    31 SSLKMLDVG-KWPIFSLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQ 94

  Fly   166 NTNTPQAVDFFRKSNLWLEQVALGAY----HSLFCDKKGHLYAVGHGKGGRLGIGLENSLPAPKR 226
            :|..|:.:|     :|..:::|..:|    |.:....:|.::..||....:||.|..|....|  
Human    95 STIEPRRLD-----SLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVP-- 152

  Fly   227 VKVSSKLSGDSIQCISVSRQHSLVLTHQSLVFACGLNTDHQLGVRDAAEQLTQFKEVVALRDKGA 291
            ..:|:.||...:..::....||||||....|||.|.|...|:|......|....:....|::|  
Human   153 CHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTGCLQNK-- 215

  Fly   292 SDLVRVIACDQHSIAYGSRC---------VYVWGAN-QGQFGINSNTPSITVPTLIKLPAKTTIR 346
              :|..|||       |..|         |||||.| .||.|:.:   |...||..::.|...||
Human   216 --VVVTIAC-------GQMCCMAVVDTGEVYVWGYNGNGQLGLGN---SGNQPTPCRVAALQGIR 268

  Fly   347 FVEANNAATVIYNEEKIITLCYADKTRYIKTPNYEDLKSISVMGGNLKNSTKGSAAALKLLMLTE 411
            .                                                                
Human   269 V---------------------------------------------------------------- 269

  Fly   412 TNVVYLWYENTQQFYRCNFSPIRLHQIKKILYKCNQVMVLSEDGCVYRGKCNQIALPSSALQEKS 476
                        |...|.::               ..:||:::|.||....|            |
Human   270 ------------QRVACGYA---------------HTLVLTDEGQVYAWGAN------------S 295

  Fly   477 RGSLDNWQDNDQNKTEISREHVIRIELQRVPNIDRATYIFCDEGFSSFAVLQESHTKYFRKPSLP 541
            .|.|     ...||:..|....:.:|..|:                                   
Human   296 YGQL-----GTGNKSNQSYPTPVTVEKDRI----------------------------------- 320

  Fly   542 RREHSFKKLLHETSDCDAVHDVVFHVDGEKFAAHKFIIYSRAPGLRDLIRCYLDKDIYLNFDHLT 606
                      .|.:.|.:.|.......|                                     
Human   321 ----------IEIAACHSTHTSAAKTQG------------------------------------- 338

  Fly   607 GKMFELILNHIYSSYWPTEDDIDCIQQSLGPANPQQRTRTCEMFLPHLEKFQLVE---------- 661
                    .|:|  .|.     .|..||              :.||||..|...:          
Human   339 --------GHVY--MWG-----QCRGQS--------------VILPHLTHFSCTDDVFACFATPA 374

  Fly   662 LTKYVQSYVRDHQFPLPNARKLFNRLYRSDHPELYDVRIVCKDGKVLGAHKCMLVARLEYFEMMF 726
            :|..:.|...|....:..:.|     ...|:|:..|::.:. |||.:.|||.:|..|.|:|    
Human   375 VTWRLLSVEPDDHLTVAESLK-----REFDNPDTADLKFLV-DGKYIYAHKVLLKIRCEHF---- 429

  Fly   727 MHLWAERSS--------VTMEGVPAEYMEPV----LDYLY----SLDNEAFCKQGYLETFLYNMI 775
                  |||        |.|    :|:..||    |:|||    ||..|.......|.||     
Human   430 ------RSSLEDNEDDIVEM----SEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATF----- 479

  Fly   776 TICDQYFIESLQNVCESLILDKISIRKCGEMLEFAAMYNCKILQKGCMDFICQNLSRVLCYRSIE 840
                 |....|:.:|:..|...|.......:|..|..|:.:.|::.|..|...:|:.|.......
Human   480 -----YRENRLKKLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFA 539

  Fly   841 QCDGETLK 848
            :.|.:.||
Human   540 EMDHDLLK 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8060NP_611117.2 ANK <46..138 CDD:238125 6/36 (17%)
ANK repeat 56..87 CDD:293786
Ank_4 57..111 CDD:290365
ANK repeat 89..121 CDD:293786 2/5 (40%)
Ank_2 95..>138 CDD:289560 6/36 (17%)
RCC1 147..195 CDD:278826 14/51 (27%)
RCC1 199..251 CDD:278826 14/51 (27%)
BTB 547..>635 CDD:295341 9/87 (10%)
BTB 684..795 CDD:279045 34/126 (27%)
BTB 697..798 CDD:197585 33/116 (28%)
SPOP_C_like 798..>834 CDD:269810 8/35 (23%)
RCBTB2XP_016875858.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.