DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg9 and LOC102557368

DIOPT Version :9

Sequence 1:NP_001261023.1 Gene:Atg9 / 36821 FlyBaseID:FBgn0034110 Length:852 Species:Drosophila melanogaster
Sequence 2:XP_038953005.1 Gene:LOC102557368 / 102557368 RGDID:7507922 Length:689 Species:Rattus norvegicus


Alignment Length:314 Identity:57/314 - (18%)
Similarity:108/314 - (34%) Gaps:100/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VLFGDTPPGGLNP---------NKTTLSDVMYPTGECLANFTWVTYLVVFIAAIYLGIRLLKMVY 197
            :|....||..|.|         :.:.:..:.|.||...|.        .|:||:.|||..|..: 
  Rat   417 ILIVRRPPYVLLPVDLGDEPWFDDSAIQTIRYATGLIRAK--------RFVAALILGITALIAI- 472

  Fly   198 HITQYADIKRFYNSALHIEDSDLDNFTWHEVQQRIRRVQAEQHMCIDKESLTELDIYHRVLRFKN 262
             :|.:|     .::...:::.....|. :::.:.:....:||.: ||.:..|.|:....|:    
  Rat   473 -VTSFA-----VSTTALVKEMQTATFV-NDLHKNVTLTLSEQKI-IDLKLETRLNALEEVV---- 525

  Fly   263 YLVALMNKQLLPVRFHIPLYGEVVSLSRGML----FNIDFILFRGPGSPFQNNWQLRDEFAVRSN 323
                            :.|..:|.::...|.    .|.|||..    :|            :..|
  Rat   526 ----------------LELGRDVTNIKTRMATRCHANYDFICV----TP------------LPYN 558

  Fly   324 QTELAQRLSKLILGVALLNLVLAPVIFVWQLIYFSFSYANILRKEPGALGLRTWSNYGRLYLRHF 388
            .||..:|....:||             :|.....|::...:.            |....:..:|.
  Rat   559 ATEEWERTKTHLLG-------------IWDDDNISYNIQELT------------SLITEMSKQHV 598

  Fly   389 NELDHELDARLNRAYDYADRYLNSFSSPLAAVIAKNLLFISGGLLLLILALGIY 442
            :.:|.   :.|.|::....:.||...      ..:..:||..|:|||::.|.|:
  Rat   599 DAVDL---SGLTRSFADGVKSLNPID------WTQYFIFIGVGILLLVVVLMIF 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg9NP_001261023.1 APG9 219..573 CDD:282028 39/228 (17%)
LOC102557368XP_038953005.1 GP41 478..671 CDD:395415 39/238 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D712239at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.