Sequence 1: | NP_898897.1 | Gene: | ved / 368201 | ZFINID: | ZDB-GENE-030813-1 | Length: | 278 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246894.1 | Gene: | CG34031 / 3885665 | FlyBaseID: | FBgn0054031 | Length: | 219 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 51/198 - (25%) |
---|---|---|---|
Similarity: | 83/198 - (41%) | Gaps: | 39/198 - (19%) |
- Green bases have known domain annotations that are detailed below.
Zfish 43 MEKHMEEKYTE-----EKYLQEKSMEKF----------MHEKYTEEKHMPEKYTE--GKRIQK-- 88
Zfish 89 ---HTHESGFSSSTEDEELSGCESEGSR----SEGSG-SRSPAAPGSVAPASGSGSPS------- 138
Zfish 139 ---SGRRPRTAFSSEQISSLERVFKRNAYLGAQDKAELCRTLKLTDKQIRNWFQNRRMKLKRTVQ 200
Zfish 201 DSL 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ved | NP_898897.1 | Homeobox | 145..196 | CDD:278475 | 21/50 (42%) |
CG34031 | NP_001246894.1 | Homeobox | 136..189 | CDD:278475 | 23/52 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |