DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CPR3

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_013633.1 Gene:CPR3 / 854897 SGDID:S000004543 Length:182 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:65/151 - (43%)
Similarity:93/151 - (61%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 TNLGPLNLELFCDQTPRACDNFIKHCA--NGY-YNNVMFHRSIRNFIVQGGD-PTGSGSGGESIW 346
            |.:|.:..||:.:..|:..:||...|.  .|: |..|.|||.|.:|::|||| ...:|.||:||:
Yeast    33 TKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIY 97

  Fly   347 GKKFEDEFKPNLT--HTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQK 409
            |.||.||   |..  |...|:|||||:||||||||||||...|..|||||.:||::..|:|.::.
Yeast    98 GSKFADE---NFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKA 159

  Fly   410 MENIEVDNKDRPIEDIIIESS 430
            :|:....: .:|..:|:||.:
Yeast   160 IESYGTAS-GKPRAEIVIEEA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 65/151 (43%)
CPR3NP_013633.1 cyclophilin_ABH_like 23..180 CDD:238907 65/151 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.