DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CPR1

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_010439.1 Gene:CPR1 / 851733 SGDID:S000002562 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:64/131 - (48%)
Similarity:89/131 - (67%) Gaps:7/131 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LGPLNLELFCDQTPRACDNFIKHCA--NGY-YNNVMFHRSIRNFIVQGGDPT-GSGSGGESIWGK 348
            :|.:..:|:.|..|:..:||...|.  .|: |....|||.|.:|::||||.| |:|:||:||:|.
Yeast    15 IGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGG 79

  Fly   349 KFEDE-FKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKMEN 412
            ||.|| ||.:  |...|:|||||:||||||||||||...|..|||||.:||::|.|.|.::|:|:
Yeast    80 KFPDENFKKH--HDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVES 142

  Fly   413 I 413
            :
Yeast   143 L 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 64/131 (49%)
CPR1NP_010439.1 cyclophilin_ABH_like 2..160 CDD:238907 64/131 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343448
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.