Sequence 1: | NP_611113.1 | Gene: | CG7747 / 36820 | FlyBaseID: | FBgn0034109 | Length: | 517 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013317.1 | Gene: | CPR6 / 850914 | SGDID: | S000004206 | Length: | 371 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 270 | Identity: | 86/270 - (31%) |
---|---|---|---|
Similarity: | 127/270 - (47%) | Gaps: | 55/270 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 289 GPLNLELFCDQTPRACDNFIKHCANG------------YYNNVMFHRSIRNFIVQGGDPTG-SGS 340
Fly 341 GGESIWGKKFEDEFKPNLT--HTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGG 403
Fly 404 LDTLQKMENIEVDNK-DRPIEDIIIESSQVFVNPFAEAAEQLAKEREEEAAGKEEIVKKEEQ--Q 465
Fly 466 KRMKEPLKV----------------YREGVGKYLKLQTVAKK--PE----------------APL 496
Fly 497 TSAQAAKKKK 506 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7747 | NP_611113.1 | RING | 25..238 | CDD:302633 | |
cyclophilin_RING | 281..439 | CDD:238904 | 65/165 (39%) | ||
CPR6 | NP_013317.1 | cyclophilin_ABH_like | 4..173 | CDD:238907 | 64/157 (41%) |
TPR repeat | 219..264 | CDD:276809 | 7/44 (16%) | ||
TPR repeat | 269..303 | CDD:276809 | 6/16 (38%) | ||
TPR repeat | 308..334 | CDD:276809 | |||
TPR_1 | 311..341 | CDD:395414 | |||
TPR repeat | 342..368 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |