DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CPR6

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_013317.1 Gene:CPR6 / 850914 SGDID:S000004206 Length:371 Species:Saccharomyces cerevisiae


Alignment Length:270 Identity:86/270 - (31%)
Similarity:127/270 - (47%) Gaps:55/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 GPLNLELFCDQTPRACDNFIKHCANG------------YYNNVMFHRSIRNFIVQGGDPTG-SGS 340
            |.:..||:.|..|:..:||:|.|...            .|...:|||.|::|:.|.||.|. :|:
Yeast    18 GRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGT 82

  Fly   341 GGESIWGKKFEDEFKPNLT--HTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGG 403
            |||||:.:|||||   |.|  |....:|||||:||||||||.|||.....||||||.:||:::.|
Yeast    83 GGESIYDEKFEDE---NFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQG 144

  Fly   404 LDTLQKMENIEVDNK-DRPIEDIIIESSQVFVNPFAEAAEQLAKEREEEAAGKEEIVKKEEQ--Q 465
            ...::.:||.:.|.: ::|:.|:.|:...|..:.:.......|...:|.....|:::|::|:  .
Yeast   145 KRIVRLIENQQCDQENNKPLRDVKIDDCGVLPDDYQVPENAEATPTDEYGDNYEDVLKQDEKVDL 209

  Fly   466 KRMKEPLKV----------------YREGVGKYLKLQTVAKK--PE----------------APL 496
            |.....||.                |...:.||:|.....|:  ||                .||
Yeast   210 KNFDTVLKAIETVKNIGTEQFKKQNYSVALEKYVKCDKFLKEYFPEDLEKEQIEKINQLKVSIPL 274

  Fly   497 TSAQAAKKKK 506
            ..|..|.|.|
Yeast   275 NIAICALKLK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 65/165 (39%)
CPR6NP_013317.1 cyclophilin_ABH_like 4..173 CDD:238907 64/157 (41%)
TPR repeat 219..264 CDD:276809 7/44 (16%)
TPR repeat 269..303 CDD:276809 6/16 (38%)
TPR repeat 308..334 CDD:276809
TPR_1 311..341 CDD:395414
TPR repeat 342..368 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.