DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CPR4

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:73/335 - (21%)
Similarity:121/335 - (36%) Gaps:113/335 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PASGRIKTMNLETKETLEQLQQDYQPAEEEASTSKRTADKFNAAHYSTGAVAASFTSTAMVPVSQ 260
            |:||:    .:.:|:.  .||:.|:|:.........|.:.|:                   |||:
Yeast    22 PSSGK----QITSKDV--DLQKKYEPSPPATHRGIITIEYFD-------------------PVSK 61

  Fly   261 IEAAIIDDDLVKYERVKKKGYVRLNTNLGPLNLELFCDQTPRACDNF------IKHCANG----- 314
                                    :.....|..||:....|:..:||      :|....|     
Yeast    62 ------------------------SMKEADLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPND 102

  Fly   315 ----YYNNVMFHRSIRNFIVQGGDPTGSGSGGESIWGKKFEDEFKPN--LTHTGRGVLSMANSGP 373
                .|.....::...|..:||| ......|..:::|.||:||   |  |.|.....|:||..||
Yeast   103 IHTYSYRKTKINKVYPNKYIQGG-VVAPDVGPFTVYGPKFDDE---NFYLKHDRPERLAMAYFGP 163

  Fly   374 NTNGSQFFITYRS--CKHLDGKHTIFGKLVGGLDTL-QKMENIEVDNKDRPIEDI--------II 427
            ::|.|:|.||.::  .:.||||..:||::..|||.| ..::..|.|...:|..::        |:
Yeast   164 DSNTSEFIITTKADGNEELDGKSVVFGQITSGLDQLMDAIQYTETDEYGKPQHELRFLYFVLEIL 228

  Fly   428 ESSQVFVNPFAEAAEQLAKEREEEAAGKEEIVKKEEQQKRMKEPLKVYREG---VGKYLKLQTVA 489
            :.|.:.               :..||..|::.|              :|.|   ||..|:.....
Yeast   229 KISNIL---------------DLHAAYTEKVEK--------------FRNGDVSVGSTLENIFRN 264

  Fly   490 KKPEAPLTSA 499
            .|...|||::
Yeast   265 DKAYTPLTTS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633 10/41 (24%)
cyclophilin_RING 281..439 CDD:238904 47/185 (25%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 45/155 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.