DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and AT1G01940

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_171696.2 Gene:AT1G01940 / 839309 AraportID:AT1G01940 Length:160 Species:Arabidopsis thaliana


Alignment Length:157 Identity:83/157 - (52%)
Similarity:112/157 - (71%) Gaps:0/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 VRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIW 346
            |.|:||||.:..|:|||:.|::.:||:..||:|||:..:|||:|:.|::|||||.|:|.||.|||
plant     3 VTLHTNLGDIKCEIFCDEVPKSAENFLALCASGYYDGTIFHRNIKGFMIQGGDPKGTGKGGTSIW 67

  Fly   347 GKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKME 411
            ||||.||.:.:|.|..||:|||||||||||||||||||....||:|.:|||||::.|.:.|..||
plant    68 GKKFNDEIRDSLKHNARGMLSMANSGPNTNGSQFFITYAKQPHLNGLYTIFGKVIHGFEVLDIME 132

  Fly   412 NIEVDNKDRPIEDIIIESSQVFVNPFA 438
            ..:....|||:.:|.:....:..||.|
plant   133 KTQTGPGDRPLAEIRLNRVTIHANPLA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 83/157 (53%)
AT1G01940NP_171696.2 Cyclophilin_PPIL3_like 1..153 CDD:238909 80/149 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.