DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and AT4G33060

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_195032.2 Gene:AT4G33060 / 829443 AraportID:AT4G33060 Length:504 Species:Arabidopsis thaliana


Alignment Length:246 Identity:102/246 - (41%)
Similarity:145/246 - (58%) Gaps:21/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 KGYVRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGE 343
            ||.|.:||..||:::||:..:.|::..||::.|..||::|.:|||.|..|:||||||||||:||:
plant    12 KGKVIVNTTHGPIDVELWPKEAPKSVRNFVQLCLEGYFDNTIFHRVIPGFLVQGGDPTGSGTGGD 76

  Fly   344 SIWGKKFEDEFKPNLTHTGRGVLSMAN-SGPNTNGSQFFITYRSCKHLDGKHTIFGKLVG-GLDT 406
            ||:|..|.|||...|..:.||:::||| |.||:||||||.|...|..||.|||||||:.| .:..
plant    77 SIYGGVFADEFHSRLRFSHRGIVAMANASSPNSNGSQFFFTLDKCDWLDKKHTIFGKVTGDSIYN 141

  Fly   407 LQKMENIEVDNKDRPIEDI-IIESSQVFVNPFAEAAEQ-LAKEREEEAAGKEE----IVKK---- 461
            |.::..::....|||::.. .|.|.:|..|||.:...: |||..||.||..:|    .|||    
plant   142 LLRLGEVDTSKDDRPLDPAPKILSVEVLWNPFEDIVPRVLAKTSEESAAEIKEPPTKPVKKLNLL 206

  Fly   462 ---EEQQKRMKEPLKVYREGVGKYLKLQTVAKKPEAPLTSAQAAKKKKLAN 509
               ||.::..|| |.|.::   |......|...|.  |..|:|:.|::.|:
plant   207 SFGEEAEEEEKE-LAVVKQ---KIKSSHDVLNDPR--LLKAEASDKERNAS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 75/160 (47%)
AT4G33060NP_195032.2 cyclophilin_CeCYP16-like 8..180 CDD:238906 77/167 (46%)
PTZ00121 <248..>497 CDD:173412 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.