DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and AT3G63400

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001190169.1 Gene:AT3G63400 / 825515 AraportID:AT3G63400 Length:570 Species:Arabidopsis thaliana


Alignment Length:222 Identity:87/222 - (39%)
Similarity:125/222 - (56%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 KKKGYVRLNTNLG--PLN---LELFCDQTPRACDNFIKHCANG-----------YYNNVMFHRSI 325
            ||...|.|:.::|  |:.   :|||.|..|:..:||...|...           ::....|||.|
plant     4 KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSSFHRVI 68

  Fly   326 RNFIVQGGD-PTGSGSGGESIWGKKFEDE-FKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCK 388
            :.|:.|||| ..|:|:|||||:|.||.|| |:  |.|.|.|||||||.|||||||||||.::...
plant    69 KGFMAQGGDFSNGNGTGGESIYGGKFSDENFR--LDHDGAGVLSMANCGPNTNGSQFFILFKRQP 131

  Fly   389 HLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIEDIII----ESSQVFVNPFAEAAEQLAKERE 449
            ||||||.:|||:|.|:..::|||.:...: .:|...:.|    |:||:..:..||..:..:|:..
plant   132 HLDGKHVVFGKVVEGMAVIKKMELVGTSD-GKPTSPVKIIDCGETSQIRAHDAAEREKGKSKKSN 195

  Fly   450 E-----EAAGKE--EIVKKEEQQKRMK 469
            :     :.:.:|  |..|||..:||:|
plant   196 KNFSPGDVSDREAKETRKKESNEKRIK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 74/179 (41%)
AT3G63400NP_001190169.1 cyclophilin_ABH_like 7..173 CDD:238907 71/168 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.