DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CYP38

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_186797.1 Gene:CYP38 / 821137 AraportID:AT3G01480 Length:437 Species:Arabidopsis thaliana


Alignment Length:347 Identity:73/347 - (21%)
Similarity:117/347 - (33%) Gaps:89/347 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PFQRKDIITIQDP-----QKLEKYDISTFYHIKKNLRVLTEEEQQERKNPASGRIKTMNLETKET 211
            |...|.|..:|.|     ..|:...:.....:::|:|..:...||.:....:|..::......|.
plant   112 PIDNKAIREVQKPLEDITDSLKIAGVKALDSVERNVRQASRTLQQGKSIIVAGFAESKKDHGNEM 176

  Fly   212 LEQLQQDYQPAEEEASTSKRTADKFNAAHYSTGAVAASFTSTAMVPVSQIEAAIIDDDLVKYE-- 274
            :|:|:...|...:.....||.|             .|......:..|..||..::|.  ..||  
plant   177 IEKLEAGMQDMLKIVEDRKRDA-------------VAPKQKEILKYVGGIEEDMVDG--FPYEVP 226

  Fly   275 -------------RVKKKGYVRLNTNLGPLNLELFCD--QTPRACDNFIKHCANGYYNNVMFHRS 324
                         .|..|..::.|.|:......:..|  ..|....||:......:|:.:...||
plant   227 EEYRNMPLLKGRASVDMKVKIKDNPNIEDCVFRIVLDGYNAPVTAGNFVDLVERHFYDGMEIQRS 291

  Fly   325 IRNFIVQGGDPTGSGSG-------------------GES--IWGKKFED----EFKPNLTHTGRG 364
             ..|:||.|||.|...|                   ||.  .:|...|:    :.:..:.....|
plant   292 -DGFVVQTGDPEGPAEGFIDPSTEKTRTVPLEIMVTGEKTPFYGSTLEELGLYKAQVVIPFNAFG 355

  Fly   365 VLSMANSG-PNTNG-SQFF-------ITYRSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDR 420
            .::||... .|.:| ||.|       :|..:...|||::.:||.:....|.|          .|.
plant   356 TMAMAREEFENDSGSSQVFWLLKESELTPSNSNILDGRYAVFGYVTDNEDFL----------ADL 410

  Fly   421 PIEDIIIESSQV------FVNP 436
            .:.| :|||.||      ..||
plant   411 KVGD-VIESIQVVSGLENLANP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633 18/90 (20%)
cyclophilin_RING 281..439 CDD:238904 46/198 (23%)
CYP38NP_186797.1 cyclophilin_TLP40_like 250..424 CDD:238905 44/185 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.