DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and AT2G38730

DIOPT Version :10

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_181407.1 Gene:AT2G38730 / 818455 AraportID:AT2G38730 Length:199 Species:Arabidopsis thaliana


Alignment Length:151 Identity:69/151 - (45%)
Similarity:91/151 - (60%) Gaps:15/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 GPLNLELFCDQTPRACDNFIKHCANGY--------YNNVMFHRSIRNFIVQGGD-PTGSGSGGES 344
            |.:.:|||.|..|:..:||.:.|....        |....|||.|::|:||.|| ....|||..|
plant    46 GRIKMELFADIAPKTAENFRQFCTGELRKAGKPLGYKECQFHRVIKDFMVQSGDFLKNDGSGCMS 110

  Fly   345 IWGKKFEDEFKPNLT--HTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVG-GLDT 406
            |:|.|||||   |.|  |||.|:||||||||||||.|||||...|..||.||.:||:::| ||..
plant   111 IYGHKFEDE---NFTAKHTGPGLLSMANSGPNTNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLV 172

  Fly   407 LQKMENIEVDNKDRPIEDIII 427
            ::|:||:.:...:||...::|
plant   173 MRKIENVAIGPNNRPKLAVVI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING-Ubox_PPIL2 41..113 CDD:438325
RING_Ubox 104..162 CDD:473075
cyclophilin_RING 281..439 CDD:238904 69/151 (46%)
AT2G38730NP_181407.1 PLN03149 14..199 CDD:178694 69/151 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.