DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CYP5

DIOPT Version :10

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_180557.1 Gene:CYP5 / 817546 AraportID:AT2G29960 Length:201 Species:Arabidopsis thaliana


Alignment Length:188 Identity:77/188 - (40%)
Similarity:105/188 - (55%) Gaps:24/188 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 VSQIEAAIIDDDLVKYERVKKKGYVRL---NTNLGPLNLELFCDQTPRACDNFIKHCANG----- 314
            ::.|:|   .:||   :.|..|.|..:   ..:.|.:.:.||....|:..:||...|...     
plant    18 IASIQA---KEDL---KEVTHKVYFDVEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGK 76

  Fly   315 -----YYNNVMFHRSIRNFIVQGGDPT-GSGSGGESIWGKKFEDE-FKPNLTHTGRGVLSMANSG 372
                 :|....|||.|.:|::||||.| |:|.|||||:|:||.|| ||  |.|||.|||||||||
plant    77 SGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFK--LKHTGPGVLSMANSG 139

  Fly   373 PNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIEDIIIESS 430
            .:|||||||||..:...|||:|.:|||:|.|:|.:.|:| .|......|...::|..|
plant   140 EDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIE-AEGKQSGTPKSKVVIADS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING-Ubox_PPIL2 41..113 CDD:438325
RING_Ubox 104..162 CDD:473075
cyclophilin_RING 281..439 CDD:238904 71/165 (43%)
CYP5NP_180557.1 cyclophilin_ABH_like 32..197 CDD:238907 72/168 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.