DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and Ppil6

DIOPT Version :10

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001419300.1 Gene:Ppil6 / 685567 RGDID:1592581 Length:332 Species:Rattus norvegicus


Alignment Length:193 Identity:70/193 - (36%)
Similarity:99/193 - (51%) Gaps:31/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 SQIEAAIIDDDLVKYERVKKKGYVRLNTN-----LGPLNLELFCDQTPRACDNFIKHC--ANGY- 315
            |.:..|:..|...|:.:..|..:|.|:.:     :|.|..||:||..||.|.||...|  .:|: 
  Rat   123 SALYEALTLDYATKFLKDTKHDFVFLDISIDLAPIGRLIFELYCDACPRTCTNFQVLCTGTSGFS 187

  Fly   316 -------YNNVMFHRSIRNFIVQGGD-PTGSGSGGESIWGKKFEDEFKPNLTHTGRGVLSMANSG 372
                   |.:.:|||.::|..||||| ..|.|..||||:|..|||| ..::.|..||||.|.|.|
  Rat   188 ERGIKLHYKDSIFHRVVKNGWVQGGDIVEGRGDDGESIYGPTFEDE-NFSVPHNKRGVLGMVNKG 251

  Fly   373 PNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIEDIIIESSQVFVN 435
            .:||||||:||.::..:||.|:..|     ||.::..|.:         :.|.||..|..:||
  Rat   252 HHTNGSQFYITLQATPYLDKKYVAF-----GLHSILYMPH---------LHDDIIPHSGTYVN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING-Ubox_PPIL2 41..113 CDD:438325
RING_Ubox 104..162 CDD:473075
cyclophilin_RING 281..439 CDD:238904 65/171 (38%)
Ppil6NP_001419300.1 cyclophilin 146..>277 CDD:469651 56/136 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.