DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and PPIAL4G

DIOPT Version :10

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001116540.1 Gene:PPIAL4G / 644591 HGNCID:33996 Length:164 Species:Homo sapiens


Alignment Length:136 Identity:61/136 - (44%)
Similarity:86/136 - (63%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LGPLNLELFCDQTPRACDNF--IKHCANGY-YNNVMFHRSIRNFIVQGGDPT-GSGSGGESIWGK 348
            ||.::::.|.|:.|:..:||  :.....|: |....|||.|..|:.||||.| .:|:|.:||:|:
Human    17 LGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTHPNGTGDKSIYGE 81

  Fly   349 KFEDEFKPNL--THTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKME 411
            ||:||   ||  .|||.|:|||||:|||||||||||.....:.|||||..|||:...::.::.||
Human    82 KFDDE---NLIRKHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAME 143

  Fly   412 NIEVDN 417
            :....|
Human   144 HFGYRN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING-Ubox_PPIL2 41..113 CDD:438325
RING_Ubox 104..162 CDD:473075
cyclophilin_RING 281..439 CDD:238904 61/136 (45%)
PPIAL4GNP_001116540.1 cyclophilin 4..162 CDD:469651 61/136 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.