DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and Ppib

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_071981.1 Gene:Ppib / 64367 RGDID:620312 Length:208 Species:Rattus norvegicus


Alignment Length:187 Identity:80/187 - (42%)
Similarity:117/187 - (62%) Gaps:12/187 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 IDDDLVKYERVKKKGYVRLNTN---LGPLNLELFCDQTPRACDNFIKHCA--NGY-YNNVMFHRS 324
            :.:|..|..:|..|.|......   :|.:...||....|:..|||:....  .|: |.|..|||.
  Rat    24 VANDKKKGPKVTVKVYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRV 88

  Fly   325 IRNFIVQGGDPT-GSGSGGESIWGKKFEDE-FKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSC 387
            |::|::||||.| |.|:||:||:|::|.|| ||  |.|.|.|.:||||:|.:|||||||||....
  Rat    89 IKDFMIQGGDFTRGDGTGGKSIYGERFPDENFK--LKHYGPGWVSMANAGKDTNGSQFFITTVKT 151

  Fly   388 KHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIED-IIIESSQVFV-NPFAEAAE 442
            ..|||||.:|||::.|:|.::|:||.:.|::|:|::| ||::..::.| .|||.|.|
  Rat   152 SWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIEVEKPFAIAKE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 73/167 (44%)
PpibNP_071981.1 cyclophilin_ABH_like 37..195 CDD:238907 71/159 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.