DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and ppil1

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001029350.1 Gene:ppil1 / 558042 ZFINID:ZDB-GENE-051009-1 Length:166 Species:Danio rerio


Alignment Length:146 Identity:76/146 - (52%)
Similarity:108/146 - (73%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 VRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIW 346
            |.|:|.:|.:.|||:.:..|:.|.||.:....||||:..|||.|::|:||||||||:|.||.||:
Zfish    14 VSLDTTMGTIVLELYWNHAPKTCKNFAELGRRGYYNSTKFHRIIKDFMVQGGDPTGTGRGGASIY 78

  Fly   347 GKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKME 411
            ||:|||||.|.|..||.|:|:|||:||:|||||||::....:.|||||||||::..|:..|.::.
Zfish    79 GKQFEDEFHPELKFTGAGILAMANAGPDTNGSQFFLSLAPTQWLDGKHTIFGRVCQGIGVLNRIG 143

  Fly   412 NIEVDNKDRPIEDIII 427
            .:|.:::|||::||.|
Zfish   144 MVETNSQDRPVDDIKI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 76/146 (52%)
ppil1NP_001029350.1 cyclophilin 16..161 CDD:294131 75/144 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.