DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and PPIL1

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:146 Identity:73/146 - (50%)
Similarity:106/146 - (72%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 VRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIW 346
            |.|.|::|.:.|||:....|:.|.||.:....||||...|||.|::|::|||||||:|.||.||:
Human    14 VYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIY 78

  Fly   347 GKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKME 411
            ||:||||..|:|..||.|:|:|||:||:|||||||:|....:.|||||||||::..|:..:.::.
Human    79 GKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVG 143

  Fly   412 NIEVDNKDRPIEDIII 427
            .:|.:::|||::|:.|
Human   144 MVETNSQDRPVDDVKI 159

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 73/146 (50%)
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 72/145 (50%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 5/10 (50%)