DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and NKTR

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001336053.1 Gene:NKTR / 4820 HGNCID:7833 Length:1463 Species:Homo sapiens


Alignment Length:254 Identity:77/254 - (30%)
Similarity:124/254 - (48%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LGPLNLELFCDQTPRACDNFIKHCANG-----------YYNNVMFHRSIRNFIVQGGD-PTGSGS 340
            :|.:..:||.|..|:.|.||:..|:..           .|....|||.::||::|||| ..|:|.
Human    20 VGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGK 84

  Fly   341 GGESIWGKKFEDEFKPN--LTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGG 403
            |||||:|..|:||   |  |.|....:|||||.|.:|||||||||.:...||||.|.:||.::.|
Human    85 GGESIYGGYFKDE---NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISG 146

  Fly   404 LDTLQKMENIEVDNKDRPIEDI-IIESSQVFVNPFAEAAEQLAKE--------------REEEAA 453
            .:.::::||::.|...||..|: :|:...:......:..|:..|:              ...|::
Human   147 FEVIEQIENLKTDAASRPYADVRVIDCGVLATKSIKDVFEKKRKKPTHSEGSDSSSNSSSSSESS 211

  Fly   454 GKEEIVKKEEQQKRMKEPLKVYREGVGKYLKLQTVAKKPEAPLTSAQAAKKKKLANGFG 512
            .:.|:..:..::::.|...||.|            :||.....:|::..:.|...|..|
Human   212 SESELEHERSRRRKHKRRPKVKR------------SKKRRKEASSSEEPRNKHAMNPKG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 63/165 (38%)
NKTRNP_001336053.1 cyclophilin 7..174 CDD:320812 63/156 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..591 13/84 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 607..627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..1072
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1129..1156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1169..1215
Arg/Ser tandem repeat-rich 1311..1348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.