DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and Moca-cyp

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster


Alignment Length:224 Identity:78/224 - (34%)
Similarity:120/224 - (53%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LGPLNLELFCDQTPRACDNFIKHCA--NGY---------YNNVMFHRSIRNFIVQGGD-PTGSGS 340
            :|.:..|||.|..|:..:||...|.  .|:         |..|:|||.:::|:||.|| ..|:|:
  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGT 90

  Fly   341 GGESIWGKKFEDE-FKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGL 404
            |||||:|..|||| |:..  |....:|||||.|.||||||||||.:...|||..|.:||:::.|.
  Fly    91 GGESIYGGTFEDESFEKK--HDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQ 153

  Fly   405 DTLQKMENIEVDNKDRPIEDIIIESSQVFVNPFAEAAEQLAKER--------EEEAAGKEEIVKK 461
            :.::::|.:.||...||::|..|.:....|.......|:..|.|        .||:..:.::|:|
  Fly   154 ELVRQLEGLPVDRNSRPLQDAAIANCGELVRQTKAKKEKKHKRRSTATEDSNSEESEAEAKVVRK 218

  Fly   462 EEQQKRMKEPLKVYRE--------GVGKY 482
            .:::||.::..|...:        |.||:
  Fly   219 AKKKKRSRKDTKSQSDSEDNETSRGNGKH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 65/163 (40%)
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 64/155 (41%)
SH3-RhoG_link 635..>718 CDD:293215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447188
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.