DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and ppid

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001002065.1 Gene:ppid / 415155 ZFINID:ZDB-GENE-040625-34 Length:371 Species:Danio rerio


Alignment Length:264 Identity:86/264 - (32%)
Similarity:130/264 - (49%) Gaps:49/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LGPLNLELFCDQTPRACDNFIKHCANG-----------YYNNVMFHRSIRNFIVQGGD-PTGSGS 340
            :|.:..|||.|..|:..:||...|...           ::....|||.|::|::|||| ...:|:
Zfish    29 VGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPFHRIIKSFMIQGGDFSNQNGT 93

  Fly   341 GGESIWGKKFEDE---FKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVG 402
            |||||:|.|||||   :|    |...|:|||||:||||||||||||.....||||||.:||:::.
Zfish    94 GGESIYGDKFEDENFHYK----HDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLK 154

  Fly   403 GLDTLQKMENIEVDNKDRPIEDIII---------ESSQVFVN--------PFAEAAEQLAKEREE 450
            |:..::.:|.:|. .:|.|::..:|         :...:.:|        .|.|.:|...|:.::
Zfish   155 GMGVVKMLEAMET-KEDNPVKPCVIAECGEHKAGDDWSIALNDGSGDAYPDFPEDSEVDFKDVDK 218

  Fly   451 EAAGKEEI-------VKKEEQQKRMKEPLKV--YREGVGKYLKLQTVAKKPEAPLTSA---QAAK 503
            ..:..|::       .|.:..|..:|:..|.  |.|..|..:...:..||.|....|.   .||.
Zfish   219 VLSVAEDLKNIGNNFFKAQNWQSAIKKYSKALRYLEMCGNIVDDDSSQKKLEPTALSCILNTAAC 283

  Fly   504 KKKL 507
            |.||
Zfish   284 KLKL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 66/182 (36%)
ppidNP_001002065.1 cyclophilin_ABH_like 16..182 CDD:238907 64/157 (41%)
TPR_11 223..304 CDD:290150 17/65 (26%)
TPR repeat 223..268 CDD:276809 8/44 (18%)
TPR_12 271..340 CDD:290160 6/17 (35%)
TPR repeat 273..303 CDD:276809 6/15 (40%)
TPR repeat 308..336 CDD:276809
TPR_1 309..341 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.