DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and cwc27

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_957397.1 Gene:cwc27 / 394078 ZFINID:ZDB-GENE-040426-1118 Length:470 Species:Danio rerio


Alignment Length:256 Identity:95/256 - (37%)
Similarity:141/256 - (55%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 GYVRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGES 344
            |.|.|.|:.|.:::||:..:||:||.||::.|..|||:..:|||.:..||||||||||:|:||||
Zfish    13 GKVLLKTSAGDIDIELWSKETPKACRNFVQLCMEGYYDGTIFHRMVPEFIVQGGDPTGTGTGGES 77

  Fly   345 IWGKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQK 409
            |:|:.|:|||...|....||:::|||:||:.||||||.|......|:.|||||||:.|  ||:..
Zfish    78 IYGRPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKVTG--DTVYN 140

  Fly   410 M---ENIEVDNKDRPIEDIIIESSQVFVNPFAEAAEQL---AKEREEEAAGK------------- 455
            |   .::..|..:||:....|.|::|..:||.:...:.   .||:.::.|.|             
Zfish   141 MLRLADVACDGDERPLNPHKIRSTEVLHSPFDDIIPREIKGKKEKNKDEAKKSQSKATKNFSLLS 205

  Fly   456 --EEIVKKEEQQKRMKEPLKVYREGVGKYLKLQTVAKKPEAPLTSAQAAKKKKLANGFGDF 514
              ||..:.||...::.:.:|      || .|......|.:..|:|.....:.:   |.|||
Zfish   206 FGEEAEEDEEMVNQVSQTMK------GK-SKSSHDLLKDDPKLSSVPVVDRNQ---GEGDF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 75/160 (47%)
cwc27NP_957397.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 76/166 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..377 19/95 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.