DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CG10907

DIOPT Version :10

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster


Alignment Length:130 Identity:30/130 - (23%)
Similarity:47/130 - (36%) Gaps:38/130 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 HILANMYVLHSFSHAAVATL-GREQFLGVYLSAGVIASFASHVFKT----------VTRQPGLSL 261
            |:|..  |:||..:|.:..| |||...| :|:...|..|...:..:          |:|:.|:..
  Fly   178 HLLHG--VIHSNGYAHLLCLNGREGGSG-FLTGRAIMDFWDRLCSSLAVRKASVMDVSRKYGMDY 239

  Fly   262 G-ASGAIMGILAYVCSQYPDTQLSILFLPMYTFSAG----------AAIKVIMGIDLAGVLLGWR 315
            . ..|...|     ||.|.:..        |.|.:|          :|:..:..|.|:..|...|
  Fly   240 RLLHGITRG-----CSWYSEWG--------YEFKSGSYALTKEAYQSAVDTLSAIPLSEFLFQGR 291

  Fly   316  315
              Fly   292  291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING-Ubox_PPIL2 41..113 CDD:438325
RING_Ubox 104..162 CDD:473075
cyclophilin_RING 281..439 CDD:238904 8/45 (18%)
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 30/130 (23%)
PTZ00121 <279..>426 CDD:173412 4/13 (31%)
CWC27_CTD 390..451 CDD:412084
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.