DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CG8336

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:152 Identity:58/152 - (38%)
Similarity:83/152 - (54%) Gaps:16/152 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 GPLNLELFCDQTPRACDNFIKHCANG----------YYNNVMFHRSIRNFIVQGGDPT-GSGSGG 342
            |.:.:||..|..|:..:||...|...          :|....||:..|.|:||.||.. ..||.|
  Fly    29 GRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSG 93

  Fly   343 ESIWGKKFEDE-FKPNLTHTGRGVLSMANSG-PNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLD 405
            |||:|..|:|| |:  |:|...||:||||.| ||:|.|||||:...|::|:|.:.:.|:::.||.
  Fly    94 ESIYGPVFDDENFE--LSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLG 156

  Fly   406 TLQKMENIEVDNKDRPIEDIII 427
            .:.:||....|..| |...|:|
  Fly   157 IVAEMEQNCTDEGD-PTAPIVI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 58/152 (38%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 58/152 (38%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447174
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.