DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CG3492

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster


Alignment Length:377 Identity:84/377 - (22%)
Similarity:145/377 - (38%) Gaps:82/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NP----ITGQKMDSKSLVKLNFHRNA---NDEYHCPALFKPFSK------NSHIVAVATTGNVYC 130
            ||    :.||..||:.....|..|..   |..:|...:..|.|:      .|||| :.....:|.
  Fly    45 NPNLVGLDGQVEDSRPKHTFNVKRQELENNYRHHQRLIPVPTSRRTMPKIRSHIV-MNEQRELYR 108

  Fly   131 WEAIDQLNIKTKNWKDLVDDTPFQRKDIITIQDPQK---------LEKYDISTFYHIKKNLRVLT 186
            .......|||.|               :.|...|.|         |...::.|..:.|.|..:.|
  Fly   109 QHRDRMSNIKGK---------------VNTYLPPPKVQIEGNGMELSYMEMLTALYKKSNNTLRT 158

  Fly   187 EEEQQERKNPASGRIKTMNLETKETLEQLQQD---------YQPAEEEASTSKRTADKFNAAHYS 242
            ..:..||.  |:||.:..||..::...||:::         :.|   ||..|||...|      |
  Fly   159 FTKSPERL--AAGRWRNANLAREKERRQLEKNKEFHKGGELFDP---EAGKSKRYKPK------S 212

  Fly   243 TGAVAASFTSTAMVPVSQIEAAIID--DDLVKYERVKKKGYVRLNTN----LGPLNLELFCDQTP 301
            :|    ||:....:.|......::|  |..|..:.::.:.|:.:...    .|.|.::||.:..|
  Fly   213 SG----SFSCEIPMHVLHRYENLMDQCDVGVLCKLLRPQIYLDIEVREARIQGRLIIQLFTEACP 273

  Fly   302 RACDNFIKHCANGYYNNVMFHRSIRNFIVQGG---DPTGSGSGGESIWGKKFEDEFKPNLTH-TG 362
            :....|::.|.....:.::|:|::....::|.   ||.      .|......|.:|:. |.| ..
  Fly   274 QVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQ------RSTELTNIEHDFEV-LNHGVD 331

  Fly   363 RGVLSMAN---SGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKME 411
            .|:||..:   .|.......|.|:::....|:|:...|||:..|:..|::::
  Fly   332 AGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633 45/189 (24%)
cyclophilin_RING 281..439 CDD:238904 31/142 (22%)
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.