DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CG17266

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:147 Identity:64/147 - (43%)
Similarity:85/147 - (57%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 TNLGPLNLELFCDQTPRACDNFIKHCANGY--------YNNVMFHRSIRNFIVQGGD-PTGSGSG 341
            |.:|.:..|||.|..||..:||.:.|...|        |....|||.|::|::|||| ..|.|:|
  Fly    28 TEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTG 92

  Fly   342 GESIWGKKFEDEFKPNLT--HTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGL 404
            ..||:|..|.||   |.|  |...|:|||||||..|||.|||||...|..|||||.:||:::.||
  Fly    93 VTSIYGNTFGDE---NFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGL 154

  Fly   405 DTLQKMENIEVDNKDRP 421
            ..::|:||:.....::|
  Fly   155 LIMRKIENVPTGPNNKP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 64/147 (44%)
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 64/147 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447192
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.