DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and ppiaa

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_997923.1 Gene:ppiaa / 336612 ZFINID:ZDB-GENE-030131-8556 Length:164 Species:Danio rerio


Alignment Length:149 Identity:70/149 - (46%)
Similarity:91/149 - (61%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LGPLNLELFCDQTPRACDNFIKHCAN--GY-YNNVMFHRSIRNFIVQGGDPTG-SGSGGESIWGK 348
            :|.:.:||..|..||..:||.:.|..  || |....|||.|..|:.||||.|. :|:||:||:|.
Zfish    17 VGRVVMELRADVVPRTAENFRQLCTGQPGYGYKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGN 81

  Fly   349 KFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKMENI 413
            ||.|| ..||.|||.|.|||||:|||||||||||.......|||||.:||::|.|||.::|:|..
Zfish    82 KFADE-NFNLKHTGAGCLSMANAGPNTNGSQFFICTALTSWLDGKHVVFGQVVEGLDVIKKVEGF 145

  Fly   414 EVDNKDRPIEDIIIESSQV 432
            ...:.....:.||.:..|:
Zfish   146 GSSSGKTSAKIIIADCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 70/149 (47%)
ppiaaNP_997923.1 cyclophilin_ABH_like 4..162 CDD:238907 69/145 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.