DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and Cyp1

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster


Alignment Length:133 Identity:66/133 - (49%)
Similarity:87/133 - (65%) Gaps:7/133 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 NTNLGPLNLELFCDQTPRACDNFIKHCA--NGY-YNNVMFHRSIRNFIVQGGDPTG-SGSGGESI 345
            |..||.:.:||..|..|:..:||...|.  .|: |...:|||.|.||:.||||.|. :|:||:||
  Fly    77 NEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSI 141

  Fly   346 WGKKFEDE-FKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQK 409
            :|.||.|| |:  |.|||.|:|||||:|.|||||||||.......||.||.:||::|.|||.::|
  Fly   142 YGNKFPDENFE--LKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKK 204

  Fly   410 MEN 412
            :|:
  Fly   205 IES 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 66/133 (50%)
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 66/133 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447178
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.