DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and Ppie

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001382655.1 Gene:Ppie / 298508 RGDID:1311411 Length:301 Species:Rattus norvegicus


Alignment Length:150 Identity:70/150 - (46%)
Similarity:94/150 - (62%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 NTNLGPLNLELFCDQTPRACDNFIKHCAN--GY-YNNVMFHRSIRNFIVQGGDPTG-SGSGGESI 345
            |...|.:.:.|..|..|...:||...|.:  |: :....|||.|..|:.||||.|. :|:||:||
  Rat   150 NKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSI 214

  Fly   346 WGKKFEDEFKPN--LTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQ 408
            :||||:||   |  |.|||.|:||||||||||||||||:|......|||||.:||::..|||.|:
  Rat   215 YGKKFDDE---NFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEITDGLDVLR 276

  Fly   409 KMENIEVDNKD-RPIEDIII 427
            ::|  ...:|| :|.:.:||
  Rat   277 QIE--AQGSKDGKPKQKVII 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 69/149 (46%)
PpieNP_001382655.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 140..298 CDD:238907 69/149 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.