DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and CG30350

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:262 Identity:51/262 - (19%)
Similarity:94/262 - (35%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KKNLRVLTEEEQQERKNPASGRIKTMNLETKE----------TLEQLQQDYQP-----AEEEAST 228
            |.|:::|.|..:..|.:   |.|.....:|..          |||:|::|.:.     .|..:..
  Fly   101 KANIQLLVEISRTMRTH---GAINPFRYDTVHAVSSIPMALLTLEKLERDNRDFGRRILEVNSEV 162

  Fly   229 SKRTADKFNAAHYSTGAVAASFTSTAMVPVSQIEAAIIDDDLVKYE------------------- 274
            ....:||         .:....:||.:.|:.....|     :.|||                   
  Fly   163 DSGLSDK---------RMREGRSSTPVAPLELPPQA-----MAKYEAFNIPLPKSDAELRRLFRP 213

  Fly   275 RVKKKGYVRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSG 339
            |:....|::....||...::|:.:..|......||.|....::..|..|...|..::    |...
  Fly   214 RIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLE----TDLM 274

  Fly   340 SGGESIWGKKFEDEFKPNLTHTGRG-VLSMANSGPN--TNGSQFFITYRSCKHLDGKHTIFGKLV 401
            ...:|:..:..|.:.|. :.|.... |||.:.:...  |:...|.|:::....::|....||::|
  Fly   275 LSSDSLLHQPLEYDAKV-IDHGASSYVLSFSKAYVTGFTHHLSFAISFKPLTVVNGSRVGFGRIV 338

  Fly   402 GG 403
            .|
  Fly   339 KG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633 16/73 (22%)
cyclophilin_RING 281..439 CDD:238904 27/126 (21%)
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 13/56 (23%)
cyclophilin 212..369 CDD:294131 28/134 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.