DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and Nktr

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_030099969.1 Gene:Nktr / 18087 MGIID:97346 Length:1556 Species:Mus musculus


Alignment Length:261 Identity:78/261 - (29%)
Similarity:130/261 - (49%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LGPLNLELFCDQTPRACDNFIKHCANG-----------YYNNVMFHRSIRNFIVQGGD-PTGSGS 340
            :|.:..:||.|..|:.|.||:..|:..           .|....|||.::||::|||| ..|:|.
Mouse   122 VGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGK 186

  Fly   341 GGESIWGKKFEDEFKPN--LTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGG 403
            |||||:|..|:||   |  |.|....:|||||.|.:|||||||||.:...||||.|.:||.::.|
Mouse   187 GGESIYGGYFKDE---NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISG 248

  Fly   404 LDTLQKMENIEVDNKDRPIEDIIIESSQVFVNPFAEAAEQLAKEREE-----------------E 451
            .:.::::||::.|...||..|:.:....|......:  :...|:|::                 |
Mouse   249 FEVIEQIENLKTDAASRPYADVRVIDCGVLATKLTK--DVFEKKRKKPTCSEGSDSSSRSSSSSE 311

  Fly   452 AAGKEEIVKKEEQQKRMKEPLKVYREGVGKYLKLQTVAKKPEAPLTSAQAAKKKKLAN--GFGDF 514
            ::.:.|:.::..:::|.|...||..            |||....::|::..::|:..:  |:.:.
Mouse   312 SSSESEVERETIRRRRHKRRPKVRH------------AKKRRKEMSSSEEPRRKRTVSPEGYSER 364

  Fly   515 S 515
            |
Mouse   365 S 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 63/164 (38%)
NktrXP_030099969.1 cyclophilin 109..276 CDD:381853 62/156 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.