DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and cyn-1

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_506561.1 Gene:cyn-1 / 179936 WormBaseID:WBGene00000877 Length:192 Species:Caenorhabditis elegans


Alignment Length:136 Identity:60/136 - (44%)
Similarity:82/136 - (60%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 GPLNLELFCDQTPRACDNFIKHCANG----------YYNNVMFHRSIRNFIVQGGDPT-GSGSGG 342
            |.:.:|||.|..|:..:||...|...          ::....|||.|..|::||||.| .:|:||
 Worm    36 GRVTMELFNDVVPKTAENFRALCTGEKGVGEQGVALHFKGSKFHRIIPEFMIQGGDFTRHNGTGG 100

  Fly   343 ESIWGKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTL 407
            |||:|.||:|| ..:|.|||.|.|||||:|||||||||||.......|||.|.:||::..|:..:
 Worm   101 ESIYGNKFKDE-NFDLKHTGPGCLSMANAGPNTNGSQFFICTVDTPWLDGGHVVFGQVTDGMSVV 164

  Fly   408 QKMENI 413
            :|:|.:
 Worm   165 KKIEKM 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 60/136 (44%)
cyn-1NP_506561.1 cyclophilin_ABH_like 22..187 CDD:238907 60/136 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.