DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and PPIH

DIOPT Version :10

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_006338.1 Gene:PPIH / 10465 HGNCID:14651 Length:177 Species:Homo sapiens


Alignment Length:150 Identity:64/150 - (42%)
Similarity:91/150 - (60%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LGPLNLELFCDQTPRACDNFIKHCANGY--------YNNVMFHRSIRNFIVQGGD-PTGSGSGGE 343
            :|.:.:|||.|..|:..:||.:.|...:        |....|||.|::|::|||| ..|.|:|..
Human    24 VGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVA 88

  Fly   344 SIWGKKFEDE-FKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTL 407
            ||:...|.|| ||  |.|:..|:||||||||:|||.|||||...|..|||||.:|||::.||..:
Human    89 SIYRGPFADENFK--LRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVM 151

  Fly   408 QKMENIEVDNKDRPIEDIII 427
            :|:||:.....::|...::|
Human   152 RKIENVPTGPNNKPKLPVVI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING-Ubox_PPIL2 41..113 CDD:438325
RING_Ubox 104..162 CDD:473075
cyclophilin_RING 281..439 CDD:238904 63/149 (42%)
PPIHNP_006338.1 cyclophilin 8..177 CDD:469651 63/149 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.